|
Monkeypox virus M1R, His Tag
| Origin of place |
Singapore  |
| Model |
S0A2014-50μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
300 |
| Hits |
75 |
| Updated |
9/1/2025 |
|
Product Specification| Species | MPXV | | Synonyms | Mpox, Monkeypox | | Accession | Q80KX3 | | Amino Acid Sequence | Protein sequence(Q80KX3, Gly2-Gly183, with C-10*His)
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGGGGGSHHHHHHHHHH
| | Expression System | HEK293 | | Molecular Weight | Theoretical: 21kDa Actual: 22-30kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied.
1 month, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles. |
BackgroundM1R is the homolog of Vaccinia virus protein L1R. It has previously been shown that the product of the VV L1R is essential for the formation of intracellular mature virions and plays a role in virion morphogenesis. In the absense of L1R, only immature virion particles are formed and proteolytic cleavage of core proteins does not occur. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|