Product Specification| Species | MPXV | | Accession | Q773E2 | | Amino Acid Sequence | Protein sequence(Q773E2, Val17-His279, with C-10*His)
VYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHGGGGSHHHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 40kDa | | Purity | >95% by SDS-PAGE | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | ·12 months from date of receipt,-20-70℃ as supplied.
·1monthe,2-8℃ under sterilie conditions after reconsitution.
·Please aviod repeated freeed-thaw cycles. |
BackgroundB6R is the homolog of Vaccinia virus protein B5R. The B5R protein is required for the wrapping of IMV by intracellular membranes, EEV formation, normal plaque size, and virus virulence. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|