Product Specification| Species | Human | | Accession | P22301 | | Amino Acid Sequence | SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRNGGGGSHHHHHHHHHH. | | Expression System | HEK293 | | Molecular Weight | 19.6 kDa (Reducing) | | Purity | >90% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Unconjugated | | Physical Appearance | Lyophilized Powder | | Storage Buffer | 0.2M PBS, pH7.4 | | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | Use within 1 month, 2 to 8 °C under sterile conditions after reconstitution. 12 months from date of receipt, -20 to -80 °C as supplied. Avoid repeated freeze-thaw cycles. |
BackgroundIL-10 (Interlukin-10) is a multicellular and multifunctional cytokine that regulates cell growth and differentiation, participates in inflammatory and immune responses, and is recognized as an inflammatory and immunosuppressive factor. It plays an important role in tumor, infection, organ transplantation, hematopoietic system and cardiovascular system, and is closely related to diseases of blood, digestion, especially cardiovascular system.Overexpression of IL-10 leads to skin leishmaniasis, and IL-10 plays a decisive role in the development of immune paralysis, temporary immune deficiency after trauma, major surgery, burns, shock and high risk bacterial/fungal infections that can be fatal. Macrophage-derived IL-10 is also associated with age-related immune deficiency.Continuous immune activation occurs when IL-10 is relatively or absolutely deficient, which can lead to chronic inflammatory bowel diseases (such as Crohn's disease), psoriasis, rheumatoid arthritis and post-transplant disease, etc.This product is the recombinant human IL-10 protein expressed from human 293 cells (HEK293). bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|