Product Specification| Species | Rat | | Synonyms | Complement C5, C5a anaphylatoxin | | Accession | P08650 | | Amino Acid Sequence | Protein sequence (P08650, Asp679-Arg755, with C-His tag)
DLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETCEQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGR | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 10.7 kDa
Observed MW: 10.7 kDa | | Purity | 锛?5% by SDS-PAGE | | Endotoxin | <0.1EU/渭g | | Conjugation | Unconjugated | | Tag | with C-His tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundC5a anaphylatoxin is a potent inflammatory mediator in the complement system. It is generated during the cleavage of complement component C5. With a relatively small molecular weight, C5a possesses remarkable biological activities. It acts as a chemoattractant, drawing various immune cells like neutrophils, monocytes, and eosinophils to the site of inflammation. Additionally, C5a can activate these immune cells, enhancing their phagocytic ability and promoting the release of inflammatory cytokines and chemokines. Moreover, C5a plays a role in increasing vascular permeability, which facilitates the migration of immune cells and plasma proteins from the bloodstream to the inflamed tissue. Dysregulation of C5a has been implicated in numerous inflammatory and autoimmune diseases, making it a crucial target for therapeutic interventions. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|