Product Specification| Species | Human | | Synonyms | Thymic stromal lymphopoietin | | Accession | Q969D9 | | Amino Acid Sequence | Protein sequence (Q969D9, Try29-Gln159, with C-His tag)
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ | | Expression System | HEK293 | | Molecular Weight | Predicted MW: 16.6 kDa
Observed MW: 17-25 kDa | | Purity | 锛?5% by SDS-PAGE | | Endotoxin | <0.1EU/渭g | | Conjugation | Unconjugated | | Tag | with C-His tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | Lyophilized from a 0.2 渭m filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. | | Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. | | Stability & Storage | 12 months from date of receipt, -20 to -70 掳C as supplied. 6 months, -20 to -70 掳C under sterile conditions after reconstitution. 1 week, 2 to 8 掳C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
BackgroundThymic stromal lymphopoietin (TSLP) is a cytokine that plays a vital role in the immune system. It was first discovered in the thymus and is mainly produced by stromal cells. TSLP functions as a key mediator in initiating and regulating immune responses. It activates dendritic cells, which then stimulate the differentiation of T helper cells, especially Th2 cells. This leads to the release of various inflammatory cytokines, contributing to the development of allergic and inflammatory diseases. In addition, TSLP is involved in immune responses against certain pathogens. Its dysregulation has been associated with several immune - related disorders, making it an important target for therapeutic interventions in diseases like asthma and atopic dermatitis. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|