| 
   
	
		
			| Description: | Recombinant Human Phospholipase A2 Receptor Protein |  
			| Species: | Human |  
			| Express System: | Escherichia coli |  
			| Protein Length: | Full length protein |  
			| Concentration: | In the label |  
			| Purity: | >95% SDS-PAGE. |  
			| Tag: | His tag N-Terminus 
 |  
			| Sequence: | MRGSHHHHHHGMASHMNLVNFHRMIKLTTGKEAALSYGFYGC HCGVGGRG
 SPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRIT
 CAKQDSCR
 SQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC
 |  
			| Amino Acid: | 21-144 |  
			| Storage: | Store at -20-80℃. Avoid repeated freeze/thaw cycles 
 |  
			| Stability: | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze -thaw cycles 
 |  
			| Applications: | ELISA, IHC, IFA,WB |  
			| Unit Size: | 200μg, 500μg, 1000μg |  
			| Note: | Product is NOT sterile! Only for research use! |  ECALBIO CO.,LTD
 Tel: +86 27 87745856
 E-mail: info@ecalbio.com
 Web: www.ecalbio.com
 HZAU,Nanhu Road, Wuhan city ,China
 bio-equip.cn Ecalbio Co.,Ltd specialize in developing reagents of immunodiagnostic technology and biological systems with higher accuracy andreliability for results of the highest quality. 
 Ecalbio builds up professional platform to develop more than 10,000 products, including antibodies, antigens, biochemicals, ELISA kits, CLIA kits, and laboratory equipments,etc.
 
 Ecalbio laboratories manufacture Antibodies, Proteins, Food safety ELISA kits, Food safety Rapid Tests, Animal Disease ELISA Kits, Animal Disease Rapid Test Kits, Laboratory equipments with incubators and diagnostic system.
 
 Ecalbio has an enthusiastic and creative R&D team, consisting with a group of experienced technicians in lateral flow immunoassay field, and set up long relationship with first-class institutes,universities,academies, to provide excellent service for human healthy and earth.
 
 Ecalbio are committed to saving lives by ensuring individuals worldwide have access to timely and correct diagnosis. Our products are used in over 100 countries worldwide by:
 Government Laboratories
 Food industry Laboratories
 Institutes
 Veterinary Clinics
 Pharmaceutical Industry.
 
 Ecalbio welcomes potential partners and distributors to explorebusiness relationships with all customer in the worldwide, focused on scie-tech, integrity, quality and service for the customers.
 
 ECALBIO CO.,LTD
 
 HZAU, Luoshi road, Wuhan 430060, China
 Tel:86-27-87745856
 Email:info@ecalbio.com
 Website: www.ecalbio.com
 |