Product Name: Recombinant Rat Alpha-2A adrenergic receptor(Adra2a)
Product Type: Transmembrane Protein
Code: CSB-CF001388RA
Size: 10μg
Uniprot NO.: P22909
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Storage Buffer: Tris-based buffer, 50% glycerol
Species: Rattus norvegicus (Rat)
Sequence: MGSLQPDAGNSSWNGTEAPGGGTRATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGGGQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDACSAPPGGADRRPNGLGPERGAGTAGAEAEPLPTQLNGAPGEPAPTRPRDGDALDLEESSSSEHAERPQGPGKPERGPRAKGKTKASQVKPGDSLPRRGPGAAGPGASGSGQGEERAGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVGCPVPYQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Gene Names: Adra2a
Protein Names: Recommended name: Alpha-2A adrenergic receptorAlternative name(s): Alpha-2A adrenoreceptor Short name= Alpha-2A adrenoceptor Short name= Alpha-2AAR Alpha-2D adrenergic receptor CA2-47
Expression Region: 1-450
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info: His-SUMO-tag
Protein Description: full length protein
More details, please refer to http://www.cusabio.com/Transmembrane-Protein/Recombinant-Rat-Alpha-2A-adrenergic-receptorAdra2a-11153775.html
bio-equip.cn
Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.
中文
