Product Name: Recombinant Balaenoptera musculus ATP synthase protein 8(MT-ATP8)
Product Type: Transmembrane Protein
Code: CSB-CF015071BEC
Size: 10μg
Uniprot NO.: P41292
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Storage Buffer: Tris-based buffer,50% glycerol
Species: Balaenoptera musculus (Blue whale)
Sequence: MPQLDTSTWLLTILSMLLTLFVLFQLKISKHSYSPNPKLVPTKTQKQQTPWNITWTKIYLPLL
Gene Names: MT-ATP8Synonyms:ATP8,,ATPASE8,,MTATP8
Protein Names: Recommended name: ATP synthase protein 8 Alternative name(s): A6L F-ATPase subunit 8
Expression Region: 1-63
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info: His-SUMO-tag
Protein DescriptionL: full length protein
More details, please visit http://www.cusabio.com/Transmembrane-Protein/Recombinant-Balaenoptera-musculus-ATP-synthase-protein-8MT-ATP8-11153780.html
bio-equip.cn
Cusabio Biotech Co., Ltd is a National High-Tech Enterprise with research, production and sales as one. Our main business includes recombinant proteins and antibodies, ELISA kits, raw materials for diagnostic reagents, food safety testing products. We mainly provide related products to well-known pharmaceutical R&D companies, diagnostic reagents manufacturers, government regulatory testing agencies, universities, enterprises and research institutes at home and abroad.
中文
