https://www.creativebiomart.net/recombinant-508cn-protein-his-tagged-528282.htm

Source :	E.coli
Tag :	His
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence :	PRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTY

Creative BioMart provides quality recombinant proteins, diagnostic antibodies and antigens, diagnostic enzymes and pharmaceutical enzymes to the research community of biology, clinical research, molecular diagnostics and biopharmaceutical drug development.

We are offering more than 1,000 recombinant proteins, peptides and antibodies. All the products are rigorously tested to meet the most demanding research needs. At the same time, lowest prices in the industry are always guaranteed.

Also, in order to leverage our core competencies and resources, Creative Biomart has formed a large number of corporate partnerships and academic collaborations for product development and distribution. We welcome potential partners and distributors to explore business relationships with Creative Biomart.