Login    Join free Add to favorites    中文
Home >Products> Reagents >Other Reagents> LR3-IGF1 Protein, Human(Media Grade)
LR3-IGF1 Protein, Human(Media Grade)
LR3-IGF1 Protein, Human(Media Grade)
Origin of place Singapore
Model UA040426-1mg
Supplier ANT BIO PTE.LTD.
Price 56
Hits 15
Updated 9/1/2025
  • Product Detail
  • Company Profile

Product Specification


SpeciesHuman
SynonymsInsulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1; LR3-IGF-1; LR3 Insulin-like Growth factor-1
Amino Acid Sequence

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Expression SystemE.coli
Molecular WeightApproximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 83 amino acids.
Purity>98% by SDS-PAGE or >90% by HPLC.
Endotoxin<0.01EU/μg
ConjugationUnconjugated
TagNo Tag
Physical AppearanceLyophilized Powder
Storage Buffer

10 mM PB, pH 7.0

ReconstitutionBefore use this product, please read the direction below carefully.
This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃.
Further dilutions should be made in appropriate buffered solutions.
Stability & Storage

For long term storage, the product should be stored ≤ -20℃.
Please avoid repeated freeze-thaw cycles after reconstitution.
12 months from date of receipt, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution.
3 months, -20 to -70℃ under sterile conditions after reconstitution.

Background

The IGFs are mitogenic, polypeptide growth factors that stimulate the proliferation and survival of various cell types, including muscle, bone, and cartilage tissue in vitro. IGFs are predominantly produced by the liver, although a variety of tissues produce the IGFs at distinctive times. The IGFs belong to the Insulin gene family, which also contains insulin and relaxin. The IGFs are similar to insulin by structure and function, but have a much higher growth-promoting activity than insulin. IGF-II expression is influenced by placenta lactogen, while IGF-I expression is regulated by growth hormone. Both IGF-I and IGF-II signal through the tyrosine kinase type I receptor (IGF-IR) , but IGF-II can also signal through the IGF-II/Mannose-6-phosphate receptor. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contain N-terminal and C-terminal propeptide regions. Recombinant human IGF-I and IGF-II are globular proteins containing 70 and 67 amino acids., respectively, and 3 intra-molecular disulfide bonds. IGF-I LR3 is a recombinant analog of human IGF-I comprised of the complete IGF-I sequence, with an Arginine substitution for the third position Glutamic acid, and a 13 amino acid length N terminus peptide extension. Specifically engineered for higher biological potency in vitro, IGF-I LR3 has an increased half-life and a binding aversion to native proteins within the body that make it ideal for both research and large-scale culturing. Recombinant Human IGF-I LR3 is a 9.1 kDa, single, non-glycosylated polypeptide chain containing 83 amino acid.

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Recently viewed products
Copyright(C) 2006-2025 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号