Login    Join free Add to favorites    中文
Home >Products> Reagents >Other Reagents> Protein A/G
Protein A/G
Protein A/G
Origin of place Singapore
Model UA040427-1mg
Supplier ANT BIO PTE.LTD.
Price 70
Hits 29
Updated 12/2/2025
  • Product Detail
  • Company Profile

Product Specification


SynonymsrProtein A/G
Amino Acid Sequence

NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE

Expression SystemE.coli
Molecular WeightApproximately 48.0 kDa.
Purity>97% by SDS-PAGE or HPLC.
ConjugationUnconjugated
TagNo Tag
Physical AppearanceLiquid
Storage Buffer

20 mM PB, with 400 mM NaCl, pH 7.4.

ReconstitutionBefore use this product, please read the direction below carefully. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃. Further dilutions should be made in appropriate buffered solutions
Stability & Storage

For long term storage, the product should be stored ≤ -20℃.
Please avoid repeated freeze-thaw cycles after reconstitution.
12 months from date of receipt, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution.
3 months, -20 to -70℃ under sterile conditions after reconstitution.

Background

The recombinant Protein A/G is a genetically engineered protein containing 5 IgG-binding regions of protein A and 2 of protein G. Cell wall binding region, cell membrane binding region and albumin binding region have been removed from the recombinant A/G-Cys to ensure the maximum specific IgG binding. The recombinant Protein A/G is ideal for making affinity gel to purification of polyclonal or monoclonal IgG antibodies. Protein A/G binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG3, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2a, IgG2c) . It also binds to total IgG from cow, goat, sheep, house, rabbit, guinea pig, pig, dog and cat.

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Recently viewed products
Copyright(C) 2006-2026 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号