Protein A/G-Cys,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Synonyms	rProtein A/G-Cys
Amino Acid Sequence	NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEC
Expression System	E.coli
Molecular Weight	Approximately 48.0 kDa.
Purity	＞97% by SDS-PAGE or HPLC.
Conjugation	Unconjugated
Tag	No Tag
Physical Appearance	Liquid
Storage Buffer	20 mM PB, with 400 mM NaCl, pH 7.4.
Reconstitution	Before use this product, please read the direction below carefully. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃. Further dilutions should be made in appropriate buffered solutions
Stability & Storage	For long term storage, the product should be stored ≤ -20℃. Please avoid repeated freeze-thaw cycles after reconstitution. 12 months from date of receipt, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. 3 months, -20 to -70℃ under sterile conditions after reconstitution.

Background

The recombinant Protein A/G-Cys is a genetically engineered protein containing 5 IgG-binding regions of protein A and 2 of protein G. Additionally there is a C-terminal cysteine for Site-Specific Conjugation. Cell wall binding region, cell membrane binding region and albumin binding region have been removed from the recombinant A/G-Cys to ensure the maximum specific IgG binding. The recombinant Protein A/G-cys is ideal for making affinity gel to purification of polyclonal or monoclonal IgG antibodies. Protein A/G binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG3, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2a, IgG2c) . It also binds to total IgG from cow, goat, sheep, house, rabbit, guinea pig, pig, dog and cat.