IL-23 Protein, Rat,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Rat
Synonyms	IL-23 p19/IL-12 p40; IL23; IL-23A; Interleukin 23; SGRF
Amino Acid Sequence	IL-23alpha: VPRSSSPDWAQCQQLSRNLCTLAWSAHTPVGQMDLLREEGEEETKSDVPRIQCGDGCDPQGLKDNSQFCLQRIRQGLVFYKHLLDSDIFTGEPSLLPDSPVDQLHTSLLGLSQLLQPEDHHWETQQMPRLSPSQQWQRSLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA IL-12beta: MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGAASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS
Expression System	HEK293
Molecular Weight	Approximately 23(IL-23A) & 43-48 kDa((IL-12B))
Purity	＞90% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH 7.4.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stability & Storage	Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Background

The IL-23 α protein is predicted to exhibit cytokine activity and contribute to interleukin-23 receptor binding. It is also anticipated to be involved in multiple processes, including the positive regulation of cytokine production, lymphocyte activation, and peptidyl-tyrosine phosphorylation. Additionally, it is expected to function upstream of T cell proliferation and in the positive regulation of RNA polymerase II transcription. This protein is localized in the extracellular space and is also predicted to be a component of the interleukin-23 complex. In terms of expression, it shows a bias toward the thymus (RPKM 15.2), spleen (RPKM 11.9), and nine other tissues. It shares orthology with the human *IL23A* gene, which encodes the interleukin-23 subunit alpha.

Product Specification

Background

Components