IL-2R alpha/CD25 His Tag Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	IL-2R alpha/CD25
Synonyms	IL2RA, CD25, p55, IL2-RA, IL-2-RA
Accession	P01590
Amino Acid Sequence	Glu22-Lys236, with C-terminal 8*His ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYKGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	43-65kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Driesen J. et al. (2008) CD25 as an immune regulatory molecule expressed on myeloid dendritic cells. Immunobiology. 213(9-10): 849-858. 2、Bien E. et al. (2008) Serum soluble interleukin 2 receptor alpha in human cancer of adults and children: a review. Biomarkers. 13(1): 1-26.

Background

The pleiotropic interleukin-2 (IL-2) cytokine is a central modulator of immune responses by shaping the differentiation and effector function of T cells. The IL-2 receptor α (IL-2Rα) is the unique chain of the trimeric IL-2 receptor and increases affinity and cells’ responsiveness to IL-2. IL-2Rα can be cleaved by different proteases resulting in soluble IL-2Rα (sIL-2Rα). Contrary to cell-bound IL-2Rα, several studies point to an antagonist role of sIL-2Rα on IL-2 signaling by interfering with binding of IL-2 to the cell-bound receptor and diminishing STAT5 phosphorylation, thereby inhibiting induction of the expression of cell bound IL-2Rα and increasing differentiation of the T cell response towards a T helper 17 phenotype, a T cell phenotype normally inhibited by IL-2.