Product Specification| Species | Human | | Synonyms | DNAM1, CD226, PTA1 | | Accession | Q15762 | | Amino Acid Sequence | Glu19-Asn247, with C-terminal 6*His&Avi tag
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNGGGSHHHHHHGLNDIFEAQKIEWHE | | Expression System | HEK293 | | Molecular Weight | 40-54kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Biotin | | Tag | Avi Tag, His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1、Koyama M. et al. (2013) Promoting Regulation Via the Inhibition of DNAM-1 After Transplantation. Blood. 121(17):3511-3520. |
BackgroundDNAX accessory molecule 1 (DNAM-1; CD226) is a costimulatory molecule belonging to the immunoglobulin superfamily. DNAM-1 is primarily expressed on NK and CD8 T cells, which has been shown to enhance the cytotoxic effector function of NK cells and T cells against tumor- and virus-infected cells. DNAM-1 is a member of the Ig superfamily, encoded by a gene on human chromosome 18q22.3, is expressed by human NK cells, T cells, a subset of B cells, monocytes and platelets. Interactions between DNAM-1 on NK cells and its ligands on tumour cells augments the NK cell–mediated cytotoxicity and cytokine production. CD155 and its related family member CD112, the known ligands for DNAM-1, broadly expressed on hematopoietic, epithelial, and endothelial cells. Moreover, it was shown that the interaction of DNAM-1 with CD112 and CD155 contributes to the NK-mediated lysis of both imDCs and mDCs. NK cells also express CD96, which shows only ∼20% homology to DNAM-1 but was also shown to recognize CD155 and promote NK cell adhesion and activation. Decreased NK cell activity has been observed in patients with PDAC, and pancreatic cancer patients have less CD226+ NK cells in the blood than do healthy controls. Dysregulation of DNAM-1 is associated with susceptibility to juvenile idiopathic arthritis, type 1 diabetes (T1D), lupus, and rheumatoid arthritis in patients. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|