Product SpecificationSpecies | Human | Accession | P43489 | Amino Acid Sequence | Leu29-Ala216, with C-terminal 6*His
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVAHHHHHH | Expression System | HEK293 | Molecular Weight | 28-30kDa (Reducing) | Purity | >95% by SDS-PAGE&RP-HPLC | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles. |
BackgroundOX40 is a member of the TNF receptor family, which is mainly known to promote effector T cell differentiation, proliferation, long-term survival, and pro-infammatory cytokines production, while inhibiting differentiation and suppressive activity of regulatory T cells (Tregs). It is expressed on activated CD4+ and CD8+ T cells, as well as on other cell types. The OX40 ligand, expressed by antigen presenting cells (APC), activates the OX40 signaling pathway which promotes a robust immune response. The interaction of OX40 with OX40 ligand results in enhanced CD4+ and CD8+ cell proliferation, stimulated cytokine production, and increased survival of antigen specific memory T cell. OX40 expression was revealed as an unfavorable prognostic marker and might be a target for immunotherapy in the future. OX40 was identified as a novel molecule in EC; its elevated expression tends to signify favorable clinical outcomes. As a second immune checkpoint, OX40 may have potential implications for the prognosis and immunomodulation of EC patients. In mice, the absence of OX40 has been shown to cause a strong reduction in the number of effector memory CD4+ cells. Furthermore, the CD8+ response was reduced and tumor growth was accelerated. Accordingly, it is comprehensible that the immune-stimulating properties of OX40 agonists could overcome some of the immunosuppressive properties within tumor environment. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|