Biotinylated B7-H3/CD276 His&Avi Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	B7-H3, CD276;B7H3, B7-H3, CD276 antigen, CD276 molecule, CD276, B7H34Ig-B7-H3, B7-H3B7 homolog 3, Costimulatory molecule
Accession	Q5ZPR3-2
Amino Acid Sequence	Leu29-Pro245, with C-terminal 10*His&Avi tag LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPHHHHHHHHHHGLNDIFEAQKIEWHE
Expression System	HEK293
Molecular Weight	38-48kDa
Purity	>95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Biotin
Tag	Avi Tag, His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Liu J. et al. (2021) Targeting B7-H3 via chimeric antigen receptor T cells and bispecific killer cell engagers augments antitumor response of cytotoxic lymphocytes. J Hematol Oncol. 14(1): 21.

Background

B7-h3 (B7 homolog 3 protein), also known as CD276, is an important immune checkpoint molecule in the B7-CD28 family. It is a type I transmembrane glycoprotein consisting of 316 amino acids and contains a putative 28AA signal peptide, a 217AA extracellular region composed of immunoglobulin constant (IgC) and variable (IgV) structures, a transmembrane region, and a 45-amino acid cytoplasmic domain. B7-H3 is a T cell co-suppressor molecule with partial co-stimulatory function. B7-H3 can effectively inhibit the function of T cells and NK cells, and also play a role in bone development. The expression of B7-H3 is low in normal tissues and is found in a variety of malignant tumors, which is closely related to the growth, metastasis, recurrence and poor prognosis of malignant tumors. B7-H3 can down-regulate T-assisted type 1 mediated immune response, inhibit CD4+T cell activation and inhibit cytokine production, and thus may play a role in promoting immune escape of cancer cells.