Biotinylated LILRB3/CD85a/LIT5 Fc&Avi Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	LILRB3, CD85a, ILT5
Accession	O75022
Amino Acid Sequence	Gly24-Glu443, with C-terminal human IgG1 Fc&Avi tag GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE
Expression System	HEK293
Molecular Weight	85-95kDa
Purity	>95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Biotin
Tag	Human Fc Tag, Avi Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Kang X. et al. (2016) Inhibitory leukocyte immunoglobulin-like receptors: Immune checkpoint proteins and tumor sustaining factors. Cell Cycle. 15(1): 25-40.

Background

LILRB3 is a member of LILRB family that is restrictively expressed on myeloid cells, including monocytes, neutrophils, eosinophils, and basophils (as well as on in vitro differentiated mast cells and osteoclasts). LILRB3 contains four cytoplasmic ITIM motifs hat may contribute to negative regulation of immune response. Ligation of LILRB3 in human myeloid cells led to inhibition of immune activation. LILRB3 may be an inhibitor of allergic inflammation and autoimmunity. However, the ligand for LILRB3 has not been identified, and the downstream signaling of LILRB3 is unclear. It is noteworthy that LILRBs, including LILRB3, are primate specific. LILRB3 is also expressed on some myeloid leukemia, B lymphoid leukemia, and myeloma cells. It is reportedly co-expressed with stem cell marker CD34 and with myeloma marker CD138.