Login    Join free Add to favorites    中文
Home >Products> Reagents >Other Reagents> MUC-1(33-167) Fc Chimera Protein, Human
MUC-1(33-167) Fc Chimera Protein, Human
MUC-1(33-167) Fc Chimera Protein, Human
Origin of place Singapore
Model UA010158-100μg
Supplier ANT BIO PTE.LTD.
Price 560
Hits 52
Updated 4/23/2026
  • Product Detail
  • Company Profile

Product Specification


SpeciesHuman
SynonymsCD227 antigen, CD227, DF3 antigen, EMA, Episialin, H23 antigen, H23AG, KL-6, MAM6, MUC-1, MUC1/ZD, Mucin-1,
Amino Acid Sequence

Ser33-Gly167, with C-terminal Human IgG1 Fc

SGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression SystemHEK293
Molecular Weight87-113kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin<0.1EU/μg
ConjugationUnconjugated
TagHuman Fc Tag
Physical AppearanceLyophilized Powder
Storage BufferPBS, pH7.4
ReconstitutionReconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Mucin 1 (MUC1) is a highly glycosylated transmembrane protein expressed mainly on the apical surface of most glandular epithelial cells, including those of the mammary gland, lung, pancreas, kidney, female reproductive tract and stomach. It is also expressed on MM cell lines, fresh patient MM cells, and plasmacytomas, as well as other hematological malignancies, including Ki-1-positive B-cell lymphomas, T-cell lymphomas, Hodgkin's disease, and malignant histiocytosis. MUC1 functions primarily in the formation of a physical barrier to lubricate and protect normal epithelial tissues and mediate signal transduction. However, aberrant expression of MUC1 occurs in cancer cells, including those of esophageal cancer, gastric cancer, breast cancer, ovarian cancer, bladder cancer and other tumors, and is especially prominent in breast cancer cells. The biological structure of MUC1 consists of both a C-terminal fragment (MUC1-C) and an N-terminal fragment (MUC1-N) linked by non-covalent interactions. Furthermore, the C-terminal fragment comprises an extracellular region, a transmembrane region and an intracellular region. Among these regions, the transmembrane region (28 amino acids) and intracellular region (72 amino acids) are highly conserved. The N-terminal fragment is located on the membrane surface and contains the signal peptide, the (30–90) variable number tandem repeat (VNTR) region, and the sea urchin sperm protein, enterokinase and agrin (SEA) domain. Aberrantly glycosylated MUC1 is associated with cellular transformation from a normal to malignant phenotype in human cancers.  Furthermore, Muc-1 binds to intercellular adhesion molecule-1 (ICAM-1), suggesting a role in cellular migration.

bio-equip.cn
Request Infomation

* Name:
Title:
* Tel:
Fax:
* E-mail:
Postcode:
Institution/Company:
Address:
* Country:
Request infomation:
yes no
Request Quotation:
yes no
* Message:
Validated Code:
refresh
I agree to share my inquiry to the other matching suppliers.



Recently viewed products
Copyright(C) 2006-2026 Bio-Equip    E-mail:web@bio-equip.cn   沪ICP备06040519号