|
TNFR-1/CD120a Protein, Human
| Origin of place |
Singapore  |
| Model |
UA040028-10μg |
| Supplier |
ANT BIO PTE.LTD. |
| Price |
136 |
| Hits |
46 |
| Updated |
3/2/2026 |
|
Product Specification| Species | Human | | Accession | P19438 | | Amino Acid Sequence | Leu30-Thr211, with C-terminal 8*His
LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 28-38kDa (Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles. |
BackgroundTNFR-1 is a member of the TNF receptor superfamily of proteins which is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Binding of membrane-bound tumor necrosis factor alpha to the membrane-bound receptor induces receptor trimerization and activation, which plays a role in cell survival, apoptosis, and inflammation. Proteolytic processing of the encoded receptor results in release of the soluble form of the receptor, which can interact with free tumor necrosis factor alpha to inhibit inflammation. Mice lacking a functional copy of this gene exhibit impaired immune function. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|