Product SpecificationSpecies | Human | Synonyms | Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1;Apolipoprotein A-I, Apo-AI, ApoA-I, Apolipoprotein A1, APOA1 | Accession | P02647 | Amino Acid Sequence | Asp25-Gln267, with N-6*His
MHHHHHHDDDDKDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ. | Expression System | E.coli | Molecular Weight | 29.6 kDa | Purity | >98% by SDS-PAGE and RP-HPLC | Endotoxin | <1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | 20mM Tris-HCl, 100mM NaCl, pH8.0 | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundApolipoprotein A-I/APOA1 mainly exists in high density lipoprotein (HDL) particles, which can prevent excessive accumulation of cholesterol in macrophages, form foam cells, deposit on the arterial wall, and cause atherosclerosis. The main function of APOA1 is to activate lecithin cholesterol acyltransferase (LCAT) in HDL complex, catalyze cholesterol esterification, and then dissolve more cholesterol-HDL complex, increase the cholesterol transport capacity of HDL particles and the ability of liver to metabolize cholesterol. Therefore, APOA1 is an important marker to evaluate the ability of blood cholesterol clearance. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|