Product Specification| Species | llama | | Synonyms | Ig gamma-2 chain C region,IgG2B Fc | | Accession | AAX73259.1 | | Amino Acid Sequence | EPKTPKPQPQPQPQPNPTTESKCPKCPAPELLGGPSVFIFPPKPKDVLSISGRPEVTCVVVDVGQEDPEVSFNWYIDGAEVRTANTRPKEEQFNSTYRVVSVLPIQHQDWLTGKEFKCKVNNKALPAPIEKTISKAKGQTREPQVYALAPHREELAKDTVSVTCLVKGFYPPDINVEWQRNRQPEPEGTYATTPPQLDNDGTYFLYSKLSVGKNTWQRGETFTCVVMHETLHNHYTQKSISQS | | Expression System | HEK293 | | Molecular Weight | 35-40kDa(Reducing) | | Purity | >95%, by SDS-PAGE under reducing conditions | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . | | Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution. · 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
BackgroundImmunoglobulin G (IgG) is a kind of monomer immunoglobulin which is developed and secreted by effective B cells and participates in secondary antibody reaction. IgG has four subclasses (IgG1,IgG2,IgG3,IgG4). IgG2 contains two members: IgG2a and IgG2b, both of which belong to the Fc fragments of IgG antibodies. Fc fragments have been shown to mediate phagocytosis, trigger inflammation, and target immunoglobulin Ig to specific tissues. In addition, some studies have shown that protein G or protein An on the surface of some staphylococci and Streptococcus strains can also specifically bind to the Fc region. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|