Product Specification| Species | Human | | Synonyms | Ig gamma-3 chain C region,IgG3 Fc | | Accession | P01860 | | Amino Acid Sequence | ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK | | Expression System | HEK293 | | Molecular Weight | 35-43 kDa(Reducing) | | Purity | >95%, by SDS-PAGE under reducing conditions | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundImmunoglobulin G (IgG) is a monomer immunoglobulin, mainly involved in secondary antibody reaction, plasma B cell synthesis and secretion, constitute 75% of human serum immunoglobulin. There are four subtypes of IgG antibody: IgG1, IgG2, IgG3 and IgG4, which decrease in turn in serum. The spatial structure of these four subtypes is similar and the heavy chain sequences of each subtype are highly homologous. IgG3 has an extended hinge region, and its core hinge region has 11 disulfide bonds, so it is unstable for protease cleavage. After pepsin cleavage, IgG3 is divided into two antigen binding sites F (ab) s and a highly conserved Fc segment, and the Fc segment has a highly conserved N-glycosylation site. Fc fragments have been shown to mediate phagocytosis, trigger inflammation, and target IgG to specific tissues. The binding ability of IgG3 to Fc γ Rs was the strongest, and the effects of ADCC, ADCP and CDC were stronger than that of IgG1. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|