IgG2b Fc (Glu97-Lys335) Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Accession	P01867-2
Amino Acid Sequence	EPSGPISTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMISLTPKVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLSRKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHEGLKNYYLKKTISRSPGL
Expression System	HEK293
Molecular Weight	32-35 kDa(reducing)
Purity	＞95%, by SDS-PAGE under reducing conditions
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is the main antibody component in normal human serum, which is produced and secreted by B cells. It is a molecule with a molecular weight of about 150kDa. IgG contains two heavy chains (50kDa) and two light chains (25kDa), which are connected by disulfide bonds. After cleavage by pepsin, IgG is divided into F (ab) s with an antigen binding site and a highly conserved Fc fragment. The Fc fragment has a highly conserved n-glycosylation site. There are 5 subtypes of IgG in mice (IgG1, IgG2a, IgG2b, IgG2c and IgG3) and 4 subtypes in rats (IgG1, IgG2a, IgG2b and IgG2c). Some studies have found that IgG2a is superior to IgG1 in activating complements. IgG2 is mainly used to neutralize antigen or block the binding of receptor ligand. In addition, human EGFR antibody IgG2 can mediate ADCC effect through myeloid cells.