Product Specification| Species | Human | | Antigen | ST6/CD82 | | Synonyms | KAI1, SAR2, TSPAN27 | | Accession | P27701-1 | | Amino Acid Sequence | Gly111-Leu228, with C-terminal 8*His Tag
GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 20-30kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1. Jin?Woo Lee,Yoo?Wook Kwon, Cheong?Whan Chae, Jae?Il Choi, Injoo Hwang,Ji?Yeon Yun, Jin?A Kang, Young?Eun Choi, Young Hyun Kim, Sang Eun Lee. KAI1(CD82) is a key molecule to control angiogenesis and switch angiogenic milieu to quiescent state. Lee et al. J Hematol Oncol (2021) 14:148 https://doi.org/10.1186/s13045-021-01147-6. |
BackgroundKAI1/CD82, a transmembrane protein and a member of the tetraspanin superfamily, is an evolutionally conserved molecule expressed in various tissue types. First identified to be involved in the T cell activation process, KAI1 is typically considered as a suppressor of metastasis. Most studies of KAI1 examined its function in suppressing metastasis and angiogenesis mainly in cancer cells and endothelial cells. Recently, we and others have reported that KAI1 regulates the cell cycle progression of the long-term repopulating hematopoietic stem cells (LT-HSCs) and muscle stem-progenitor cells. Thus, KAI1 has different roles in each cell and organ type. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|