Product Specification| Species | Human | | Antigen | ELOB/ELOC/VHL | | Synonyms | Elongin B & Elongin C & VHL, ELOB & ELOC & VHL Complex, Elongin B & Elongin C & VHL Complex | | Accession | Q15370、Q15369、P40337 | | Amino Acid Sequence | ELOB flag tag, Human, Asp2-Gln118, N-flag
DYKDDDDKDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
ELOC flag tag, Human, Asp2-Cys112, N-flag
DYKDDDDKDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
VHL His tag, Human, Pro2-Asp213, N-His
HHHHHHHHHHGGGSGGGSPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD | | Expression System | Baculovirus-InsectCells | | Molecular Weight | 14 kDa (ElOB) and 13.3 kDa (ElOC) and 25.9 kDa (VHL) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Physical Appearance | Liquid | | Storage Buffer | 40mM Tris, 200mM NaCl, 2.2mM KCl, 20% glycerol, 3mM DTT, pH8.0 | | Reconstitution | N.A | | Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles. | | Reference | 1.Cell Chem Biol. 2023 Jul 20;30(7):766-779.e11. Epub 2023 Jun 23.
2.bioRxiv. 2023 May 24;2023.05.22.541439. PreprintOkumura F., et al. (2012) Front. Oncol.
3.Mod Pathol. 2023 Apr 23;36(8):100194. Online ahead of print. |
BackgroundELOB (elongin B) is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units.
ELOB and ELOC(elongin C) form a heterodimer that serves as the regulatory subunit for the Elongin complex-a general transcription elongation factor that increases RNA Polymerase II transcription through template-encoded arresting sites. The ELOB/ELOC complex also binds to the "BC-box motif" found in many proteins in the VHL-box and SOCS-box protein families.
The VHL(von Hippel-Lindau disease tumor suppressor) binds to ELOB and ELOC and thereby inhibits transcription elongation. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|