Product Specification| Species | Mouse | | Accession | Q9D659 | | Amino Acid Sequence | Phe33-Ala191, with C-terminal 8*His
FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAAGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 33-43 kDa(Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundB7-H5, also known as VISTA, is one of the negative immune checkpoints of the B7 family. B7-H5 which is the most conserved among the B7 membersis mainly expressed in myeloid cells such as macrophages, monocytes, dendritic cells, and T cellsVISTA is a type I transmembrane protein consisting of a single N-terminal immunoglobulin (Ig) V domain, an approximately 30 amino acid (aa) stalk, a transmembrane domain, and a 95 aa cytoplasmic tail. It can regulate a variety of immune cells, including B cells, T cells, and endothelial cells by binding to its putative receptor(s) on these cells.The expression of B7-H5 is closely related to the diagnosis, severity and prognosis of tumors. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|