|
Parvalbumin His Tag Protein, Human
Origin of place |
Singapore  |
Model |
UA010608-100μg |
Supplier |
ANT BIO PTE.LTD. |
Price |
560 |
Hits |
6 |
Updated |
8/27/2025 |
|
Product SpecificationSpecies | Human | Antigen | Parvalbumin | Synonyms | PVALB, D22S749 | Accession | P20472 | Amino Acid Sequence | Met1-Ser110, with N-terminal 8*His
HHHHHHHHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES | Expression System | E.coli | Molecular Weight | 16kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1. Virchows Arch. 2021 Apr;478(4):785-791. Epub 2020 Jun 10. |
BackgroundParvalbumin is a cytosolic calcium-binding protein expressed in the distal convoluted tubule of the renal nephron that is structurally and functionally similar to calmodulin and troponin C. Among epithelial renal tumors, the reactivity for parvalbumin is observed in chromophobe renal cell carcinomas and frequently in oncocytomas. This protein is thought to be involved in muscle relaxation. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
|
|