Product Specification| Species | Human | | Accession | Q68D85 | | Amino Acid Sequence | Asp25-Ser262, with C-terminal 8*His
DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 45-60 kDa(Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1mg/mL according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundB7-H6 (encoded by gene NCR3LG1) is a type I transmembrane protein of B7 family. It consists of two extracellular Ig-like domains (IgV and IgC), an α-helical transmembrane domain, and a C-terminal sequence homologous to group-specific antigen (GAG) proteins. This C-terminal sequence has various signaling motifs, including ITIM-, SH-2-, and SH-3-binding motifs. B7-H6 can bind its receptor NKp30 to exert anti-tumor effects by helping NK cells to recognize abnormal cells. B7-H6 is expressed in several tumor cell lines, both in vitro and in vivo, including esophageal squamous cell carcinoma, oral squamous cell carcinoma and breast cancer. but remains undetected in healthy cells thus far, and is therefore an excellent tumor marker. In recent years, B7-H6 expression has been reported to be upregulated in certain cancers and to be associated with tumor differentiation, stage and progression. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|