TREM2 Fc Chimera Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	TREM2
Synonyms	TREM-2, Triggering receptor expressed on monocytes 2
Accession	Q9NZC2-1
Amino Acid Sequence	His19-Ser174, with C-terminal Human IgG1 Fc HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System	HEK293
Molecular Weight	55-60kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	Human Fc
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Deczkowska A, Weiner A, Amit I. The physiology, pathology, and potential therapeutic applications of the TREM2 signaling pathway. Cell. (2020) 181:1207-17. 10.1016/j.cell.2020.05.003 2. Guerreiro R, Wojtas A, Bras J, Carrasquillo M, Rogaeva E, Majounie E, et al.. TREM2 variants in Alzheimer's disease. N Engl J Med. (2013) 368:117-27. 10.1056/NEJMoa1211851 3. Molgora M, Esaulova E, Vermi W, Hou J, Chen Y, Luo J, et al.. TREM2 modulation remodels the tumor myeloid landscape enhancing Anti-PD-1 immunotherapy. Cell. (2020) 182:886-900.e817. 10.1016/j.cell.2020.07.013.

Background

Triggering receptor expressed on myeloid cells-2 (TREM2) is a transmembrane receptor of the immunoglobulin superfamily and a crucial signaling hub for multiple pathological pathways that mediate immunity. Expressed in the brain, specifically in microglia and in the fusiform gyrus. TREM2 can inhibit the phagocytic function of dendritic cells and macrophages, thereby affecting related immune signaling pathways. TREM2 has vital roles in Alzheimer's disease and other neurodegenerative diseases, and is involved in numerous immune and inflammatory pathways that contribute to the etiology of these diseases. TREM2 has been studied widely in microglia, where TREM2 functions in neuronal debris clearance to counteract the inflammatory response. TREM2 can alter the morphology of tumor-infiltrating macrophages, inhibit tumor growth, and enhance checkpoint blocking therapy. TREM2 can function as a prognostic marker in various malignant tumors because of its role in tumorigenesis and tumor immunity.