Product Specification| Species | Human | | Accession | O75144 | | Amino Acid Sequence | Asp19-Ser258, with C-terminal 8*His
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 45-56 kDa(Reducing) | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundICOS ligand (ICOSLG) is also known as B7 homolog 2 (B7-H2), B7-related protein 1 (B7RP-1) and CD antigen CD275, which belongs to the immunoglobulin superfamily and BTN/MOG family. ICOSLG contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. Isoform 1 is widely expressed, while isoform 2 is detected only in lymph nodes, leukocytes and spleen. B7-H2 is ligand for the T-cell-specific cell surface receptor ICOS. B7-H2 acts as a costimulatory signal for T-cell proliferation and cytokine secretion and induces also B-cell proliferation and differentiation into plasma cells. B7-H2 could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by costimulating memory T-cell function. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|