B7-H2/ICOSLG His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Accession	O75144
Amino Acid Sequence	Asp19-Ser258, with C-terminal 8*His DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSHHHHHHHH
Expression System	HEK293
Molecular Weight	45-56 kDa(Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Background

ICOS ligand (ICOSLG) is also known as B7 homolog 2 (B7-H2), B7-related protein 1 (B7RP-1) and CD antigen CD275, which belongs to the immunoglobulin superfamily and BTN/MOG family. ICOSLG contains one Ig-like C2-type (immunoglobulin-like) domain and one Ig-like V-type (immunoglobulin-like) domain. Isoform 1 is widely expressed, while isoform 2 is detected only in lymph nodes, leukocytes and spleen. B7-H2 is ligand for the T-cell-specific cell surface receptor ICOS. B7-H2 acts as a costimulatory signal for T-cell proliferation and cytokine secretion and induces also B-cell proliferation and differentiation into plasma cells. B7-H2 could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by costimulating memory T-cell function.