Product SpecificationSpecies | Human | Synonyms | Fibroblast growth factor 21 | Accession | Q9NSA1 | Amino Acid Sequence | His29-Ser209, with N-terminal 6*His
MHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS | Expression System | E.coli | Molecular Weight | 25 kDa(Reducing) | Purity | >97% by SDS-PAGE & RP-HPLC | Endotoxin | <1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | 20mM Tris, 100mM NaCl, pH7.5 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles. |
BackgroundFibroblast growth factor 21 (FGF-21) is a pleiotropic hormone considered as a major regulator of energy homeostasis. FGF-21 is mainly secreted by the liver, but it may also be expressed in skeletal muscle. In this sense, FGF-21 protein expression is induced by insulin in C2C12 myocytes, and FGF21 mRNA is upregulated by hyperinsulinemia in skeletal muscle in young healthy men. Moreover, it has been suggested that FGF-21 is a signal secreted by the skeletal muscle to communicate with adipose tissue under stress conditions. FGF21 has been shown to be a major regulator of hepatic lipid metabolism, with FGF-21 overexpressing mice being resistant to diet-induced obesity. Interestingly, recent studies suggest that FGF21 may exert anti-inflammatory actions in the pancreas, heart, and skeletal muscle. A reduction in the JNK and NF-κB signaling pathways has been proposed as the potential mechanism implicated in the FGF-21 anti-inflammatory effects. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|