Cyclophilin A His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Antigen	Cyclophilin A
Synonyms	Peptidyl-prolyl cis-trans isomerase A, PPIase A, Cyclosporin A-binding protein, Rotamase A
Accession	P62937
Amino Acid Sequence	Met1-Glu165, with C-terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH
Expression System	E.coli
Molecular Weight	20kDa
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	20mM Tris，250mM NaCl, pH 6.0
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. Cell Death Dis. 2013 Oct 31;4(10):e888. 2. Biochemistry (Mosc). 2022 Mar;87(3):259-268.

Background

Cyclophilin A (CyPA, 18 kDa) is a ubiquitously distributed protein belonging to the immunophilin family. Cyclophilin A (CyPA) is a peptidyl-prolyl cis-trans isomerase that exists in the intracellular and secretory forms and has multiple functions. Intracellular CypA takes part in folding, transport, and assembly of proteins; regulates cell proliferation; is a ligand for cyclosporine A (CsA), mediating its immune-suppressive activity; mediates signal transduction from a T cell receptor, and controls the balance of T helpers 1 and 2, inhibiting activity of T helpers 2.