IL-31 Protein, Canine,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Canine
Synonyms	IL-31,IL31,Interleukin-31
Accession	C7G0W1
Amino Acid Sequence	Ser24-Gln159 with C terminal 8*His MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH
Expression System	E.coli
Molecular Weight	17kDa (Reducing)
Purity	＞95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4, 5% Trehalose.
Reconstitution	econstitute at 0.1-0.5mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1. J Allergy Clin Immunol. 2023 Jul 13;S0091-6749(23)00888-6. Online ahead of print. 2. Allergy. 2023 Jul 13. Online ahead of print. 3. Clin Exp Med. 2023 Jul 1. Online ahead of print.

Background

IL-31 which produced by activated Th2-type T cells. IL-31 signals through a receptor composed of IL-31 receptor A and oncostatin M receptor. IL-31 activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL-31 has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. Patients with atopic dermatitis, chronic spontaneous urticaria, allergic contact dermatitis, prurigo nodularis, primary cutaneous lymphoma and mastocytosis exhibit increased serum levels of IL-31 protein and elevated IL-31 mRNA in the skin.