Product SpecificationSpecies | Human | Synonyms | FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE | Accession | P62942 | Amino Acid Sequence | Met1-Glu108, with C terminal 8*His Tag
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH | Expression System | E.coli | Molecular Weight | 13kDa | Purity | >95% by SDS-PAGE | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| Reference | 1. Curr Genet. 2021 Jun;67(3):383-388.
2. Genetics. 1999 Mar;151(3):935-44. |
BackgroundFKBP12 associates with several large protein complexes, including the multi-drug resistance pump and the ryanodine, inositol trisphosphate (IP3)and the type I TGF-β receptor. FKBP12 was originally identifed as a FK506 binding protein. FK506 is a clinically used immunosuppressant derived from Streptomyces tsukubaensis. The FK506–FKBP12 binary complex inhibits the protein phosphatase calcineurin, thereby preventing T lymphocytes from producing interleukin-2 in mammals. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|