Product SpecificationSpecies | Human | Synonyms | Fatty acid binding protein 8, P2, PMP2 | Accession | P02689 | Amino Acid Sequence | Ser2-Val132, with N-terminal 8*His
MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV | Expression System | E.coli | Molecular Weight | 18kDa (Reducing) | Purity | >95% by SDS-PAGE & RP-HPLC | Endotoxin | <1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundFABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|