Product Specification| Species | Human | | Synonyms | CEA, CEACAM 7, CGM 2, CGM2 | | Accession | Q14002 | | Amino Acid Sequence | Thr36-Ser242, with C-terminal 8*His
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASGGGSHHHHHHHH | | Expression System | HEK293 | | Molecular Weight | 33-55kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1.Tchoupa, A.K. et al. (2014) Cell Commun. Signal. 12:27. |
BackgroundCarcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM-7), also known as CGM2, is an approximately 40 kDa GPI-anchored glycoprotein in the CEACAM family of adhesion molecules. Mature human CEACAM-7 consists of two Ig-like domains followed by the GPI anchor. Alternative splicing generates a short isoform that lacks the second Ig-like domain. CEACAM-7 is preferentially expressed on the luminal surface of epithelial cells near the mouth of colonic crypts and on pancreatic ductal epithelial cells. It is down-regulated during colorectal adeno bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|