CEACAM-7 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	CEA, CEACAM 7, CGM 2, CGM2
Accession	Q14002
Amino Acid Sequence	Thr36-Ser242, with C-terminal 8*His TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	33-55kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1.Tchoupa, A.K. et al. (2014) Cell Commun. Signal. 12:27.

Background

Carcinoembryonic antigen-related cell adhesion molecule 7 (CEACAM-7), also known as CGM2, is an approximately 40 kDa GPI-anchored glycoprotein in the CEACAM family of adhesion molecules. Mature human CEACAM-7 consists of two Ig-like domains followed by the GPI anchor. Alternative splicing generates a short isoform that lacks the second Ig-like domain. CEACAM-7 is preferentially expressed on the luminal surface of epithelial cells near the mouth of colonic crypts and on pancreatic ductal epithelial cells. It is down-regulated during colorectal adeno