Product Specification| Species | Human | | Accession | P05452 | | Amino Acid Sequence | Glu22-Val202, with C-terminal 6*His
EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIVGGGSHHHHHH | | Expression System | HEK293 | | Molecular Weight | 24-30kDa (Reducing) | | Purity | >95% by SDS-PAGE&RP-HPLC | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundC-type lectin domain family 3 member B (CLEC3B) is a hexameric, multimodular extracellular matrix protein with several molecular forms that are created through alternative splicing and protein modifications. It is highly conserved amongst vertebrates, and molecular phylogeny indicating that it evolved before fibronectin. CLEC3B has many extracellular binding partners, including matrix components, soluble factors and pathogens; it also influences cell phenotype directly through interactions with cell surface receptors. The synthesis of CLEC3B is strictly regulated, and it is widely distributed in embryonic tissues while restricted in adult tissues. CLEC3B is also de novo expressed in wound healing or pathological state, including chronic inflammation and cancer. First described as a modulator of cell adhesion, CLEC3B also directs a plethora of cell signaling and gene expression programs by shaping mechanical and biochemical cues in the cellular microenvironment. Exploitation of the pathological expression and function of CLEC3B is emerging as a promising strategy to develop new diagnostic, therapeutic and bioengineering tools. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|