Product SpecificationSpecies | Human | Synonyms | Gal-3 | Accession | P17931 | Amino Acid Sequence | Ala2-Ile250, with C-terminal 6*His
ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIHHHHHH | Expression System | HEK293 | Molecular Weight | 35-41kDa (Reducing) | Purity | >95% by SDS-PAGE&RP-HPLC | Endotoxin | <0.1EU/μg | Conjugation | Unconjugated | Tag | His Tag | Physical Appearance | Lyophilized Powder | Storage Buffer | PBS, pH7.4 | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
|
BackgroundGalectin-3 (Gal-3) is a member of the galectin family of carbohydrate binding proteins which have affinity for beta-galactoside. Gal-3 is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. Gal-3 can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. Gal-3 is expressed in the nucleus, cytoplasm, mitochondrion, cell surface and extracellular space. Gal-3 plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation and exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants. Gal-3 plays an important role in the pathogenesis of neuroinflammatory and neurodegenerative disorders, such as multiple sclerosis, Alzheimer's disease, Parkinson's disease, and Huntington's disease. On the other hand, there is also evidence of the protective role of Gal-3 due to its anti-apoptotic effect in target cells. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|