CD79A His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	CD79A, Ig-alpha, MB-1 membrane glycoprotein, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein
Accession	P11912
Amino Acid Sequence	Leu33-Arg143, with C-terminal 8*His LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	35-46kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Venkitaraman A R. et al. (1991) The B-cell antigen receptor of the five immunoglobulin classes. Nature. 352(6338): 777-781. 2、Kim K M. et al. (1993) Signalling function of the B-cell antigen receptors. Immunol Rev. 132: 125-146.

Background

CD79A encodes CD79a (also known as Ig-α) belonging to the Ig superfamily, a transmembrane protein that associate with CD79a(Ig-β) via a disulfide bond. CD79A and CD79B encoded by the mb-1 and B29 genes, respectively. CD79A and CD79B are proximal B-cell receptor subunits that contain an immunoreceptor tyrosine-based activation motif (ITAM) that frequently harbors somatic mutations. Ig-α and Ig-β form a disulfide-linked heterodimer that associates with membrane-bound Ig (mIg)3 molecules of every Ig class to form the B cell Ag receptor (BCR) complex. The variable region of the H and L (IgH and IgL) chains of the mIg molecules constitute the Ag-binding portion of the BCR, whereas the Ig-α/Ig-β heterodimer is its signaling component.