CD7 Ligand/SECTM1 His Tag Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Antigen	CD7 Ligand
Synonyms	CD7 Ligand, SECTM1, K12
Accession	NP_663348
Amino Acid Sequence	Gln28-Thr165, with C-terminal 8*His QNKSWDNPICTEGILSVPRGNPAVMTCNISNTFTDVTIQLSANGKDKTIFDKKPQGNFSWRGWELQVQGGLAQLVIKDTQDDHTGIYLWQLHGRQRCYKNITLNILEPSNEDKVPDTTLFTSFPDHAKSSPIEGKPGTGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	25-35kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Lyman S D. et al. (2000) Identification of CD7 as a cognate of the human K12 (SECTM1) protein. J Biol Chem. 275(5): 3431-3437. 2、Lam G K. et al. (2005) Expression of the CD7 ligand K-12 in human thymic epithelial cells: regulation by IFN-gamma. J Clin Immunol. 25(1): 41-49.

Background

SECTM1 (secreted and transmembrane 1), also called K12, is either found as an approximately 27 kDa intracellular type I transmembrane protein that shows a perinuclear, Golgi‑like staining pattern, or as a 20 kDa soluble, secreted form. SECTM1 is expressed on thymic epithelial and fibroblast cells, breast cancer and leukemia cell lines, and neutrophils but not in peripheral lymphocytes. SECTM1 is expressed on cytomembrane, which is identified as a CD7 ligand.CD7 is expressed in T and natural killer (NK) cells, which could be activated by its ligand SECTM1, thus promoting the proliferation of T and NK cells. SECTM1 strongly costimulates CD4 and CD8 T cell proliferation and induces IFN-γ production, likely via a CD7-dependent mechanism. In addition, SECTM1 synergizes with suboptimal anti-CD28 to strongly augment T cell functions. A robust induction of IL-2 production when SECTM1 and anti-CD28 signals were present with TCR ligation.