Product Specification| Species | Mouse | | Synonyms | Fc gamma RIV, CD16-2, Fcgr4 | | Accession | A0A0B4J1G0 | | Amino Acid Sequence | Gly21-Gln203, with C-terminal 8*His&Avi tag
GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ GGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE | | Expression System | HEK293 | | Molecular Weight | 28-35kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <1EU/μg | | Conjugation | Biotin | | Tag | Avi Tag, His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1、Hirano M. et al. (2007) IgEb immune complexes activate macrophages through FcγRIV binding. Nature Immunology. 8: 762-771. |
BackgroundFc γ RIV (Low affinity immunoglobulin gamma Fc region receptor IV), also known as CD16-2 (Fc γ RIV), belongs to the Fc γ receptor family. There are three types of Fc γ receptors: Fc γ RI (CD64), Fc γ RII (CD32) and Fc γ RIII (CD16). Fc γ RI (CD64) has a high affinity for IgG monomer, while Fc γ RII (CD32) and FC γ RIII (CD16) have a relatively low affinity for IgG. Human CD16 is encoded by two genes, Fc γ RIIIA and Fc γ RIIIB. The gene sequence of CD16-2 is more similar to that of human Fc γ RIIIA protein. The combination of FcγRIV and IgG2a can promote bone cell differentiation. The combination of FcγRIV and IgE can promotes macrophage-mediated phagocytosis, antigen presentation, and proinflammatory cytokine production. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|