Biotinylated Fc γ RIV/CD16-2 His&Avi Tag Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	Fc gamma RIV, CD16-2, Fcgr4
Accession	A0A0B4J1G0
Amino Acid Sequence	Gly21-Gln203, with C-terminal 8*His&Avi tag GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ GGGSGGGSHHHHHHHHGLNDIFEAQKIEWHE
Expression System	HEK293
Molecular Weight	28-35kDa
Purity	>95% by SDS-PAGE
Endotoxin	<1EU/μg
Conjugation	Biotin
Tag	Avi Tag, His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Hirano M. et al. (2007) IgEb immune complexes activate macrophages through FcγRIV binding. Nature Immunology. 8: 762-771.

Background

Fc γ RIV (Low affinity immunoglobulin gamma Fc region receptor IV), also known as CD16-2 (Fc γ RIV), belongs to the Fc γ receptor family. There are three types of Fc γ receptors: Fc γ RI (CD64), Fc γ RII (CD32) and Fc γ RIII (CD16). Fc γ RI (CD64) has a high affinity for IgG monomer, while Fc γ RII (CD32) and FC γ RIII (CD16) have a relatively low affinity for IgG. Human CD16 is encoded by two genes, Fc γ RIIIA and Fc γ RIIIB. The gene sequence of CD16-2 is more similar to that of human Fc γ RIIIA protein. The combination of FcγRIV and IgG2a can promote bone cell differentiation. The combination of FcγRIV and IgE can promotes macrophage-mediated phagocytosis, antigen presentation, and proinflammatory cytokine production.