Product Specification| Species | Human | | Synonyms | CD74, DHLAG, HLADG, Ia-GAMMA, p33, CLIP, INVG34 | | Accession | P04233-2 | | Amino Acid Sequence | Gln73-Met232, with N-terminal 8*His
HHHHHHHHGGGSQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM | | Expression System | HEK293 | | Molecular Weight | 28-33kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles. | | Reference | 1、Zola H. et al. (2007) CD molecules 2006-human cell differentiation molecules. J Immunol Methods. 318(1-2): 1-5. 2、Ho I C. et al. (2009) GATA3 and the T-cell lineage: essential functions before and after T-helper-2-cell differentiation. Nat Rev Immunol. 9(2): 125-135. 3、Matesanz-Isabel J. et al. (2011) New B-cell CD molecules. Immunology Letters. 134(2): 104-112. |
BackgroundCD74 (MHC class II invariant chain, Ii) is a non-polymorphic type II transmembrane glycoprotein. It was initially identified to act mainly as an MHC class II chaperone. However, it is clear that CD74 has a much wide range of biological functions in physiological and pathological situations in addition to its regulatory roles on cell surface MHC II expression. CD74 also participates in other non-MHC II protein trafficking. Importantly, CD74 molecule is a cell membrane high-affinity receptor for macrophage migration inhibitory factor (MIF), D-dopachrome tautomerase (D-DT/MIF-2), and bacterial proteins that also behave as an accessory signaling molecule, which undergoes regulated intramembrane proteolysis (RIP) upon its ligand binding. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|