LRP10 His Tag Protein, Mouse,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Mouse
Synonyms	LRP10, LRP9, MST087, MSTP087
Accession	Q7TQH7
Amino Acid Sequence	Arg18-Lys441, with C-terminal 10* His RPDRITFPRSACEAPPAVLSEVQGTLQRPLGRDSRSSPANCTWVILGSKDQTVTVRFQKLHLACGSEHLILHSPLQPPISLCEAPSGPLQLPGGNVTITYSYAGARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCSSDPFPNLNPAPAPTLACNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLSYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSSGRGFNATYHVRGYCLPWDRPCGLGSGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHFPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCTDGSDEWDCSYALPRKGGGSGGGSHHHHHHHHHH
Expression System	HEK293
Molecular Weight	56-61kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Jeong Y H. et al. (2010) The low-density lipoprotein receptor-related protein 10 is a negative regulator of the canonical Wnt/beta-catenin signaling pathway. Biochem Biophys Res Commun. 392(4): 495-499. 2、Beisiegel U. et al. (1991) Lipoprotein lipase enhances the binding of chylomicrons to low density lipoprotein receptor-related protein. Proc Natl Acad Sci U S A. 88(19): 8342-8346. 3、Strickland D K. et al. (1990) Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor. J Biol Chem. 265(29): 17401-17404.

Background

Human LDLR-related protein 10 (LRP10, called LRP9 in mice) is a member of a new subfamily of LDLR that includes two other receptors, LRP3 and LRP12. This unique subfamily of LDLR is characterized by extracellular CUB domains and large cytoplasmic tails containing acidic dileucine (DXXLL) motifs. LRP10 is expressed in various tissues (including the brain), and is localized in the TGN and endosomes. It is reported that LRP10 is a functional amyloid precursor protein (APP) receptor involved in APP trafficking and processing. Some studies have suggested a role of LRP10 in ligand trafficking between the trans-Golgi network, endosomes, and the plasma membrane. Recently, LRP10 has been associated with PD, Parkinson's disease Dementia (PDD) and Dementia with Lewy Bodies (DLB) by linkage analysis and positional cloning in an Italian family with late-onset PD. Moreover, LRP10 variants have been found in individuals diagnosed with progressive supranuclear palsy and amyotrophic lateral sclerosis.