IL-12 R beta 1 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	IL-12 R beta 1, CD212, IMD30, IL12RB
Accession	P42701
Amino Acid Sequence	Cys24-Glu540, with C-terminal 8* His CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	74-84kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Oppmann B. et al. (2000) Novel p19 protein engages IL-12p40 to form a cytokine, IL-23, with biological activities similar as well as distinct from IL-12. Immunity. 13(5): 715-725. 2、Robinson R T. IL12Rbeta1: the cytokine receptor that we used to know. Cytokine. 2015;71(2): 348-359.

Background

The human IL-12 R subunit is a member of the cytokine receptor superfamily. The IL-12 R beta (IL-12Rβ) gene is located on chromosome 19p13 and has 17 exons. The receptor is composed of two subunits—IL-12Rβ1 and IL-12Rβ2—and is a member of the gp130 cytokine receptor superfamily. IL-12R are located mainly on T cells and NK cells, and stimulate TH1 and NK cell growth, while inhibiting TH2 cell responses. IL-12Rβ1 encodes the β1 chain common to the receptors for IL-12 and IL-23. Human IL-12Rβ1 is an autosomal gene that is essential for mycobacterial disease resistance and T cell differentiation. Mutations in the IL-12Rβ1 gene accounts for 38% of cases of MSMD. IL12Rβ1 is a cell surface receptor that binds the IL12p40 domain of IL12/IL23, and cooperates with co-receptors IL12Rβ2 or IL23R to initiate intracellular STAT signaling.