CD72 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	CD72, LYB2, CD72b, Lyb-2, Lyb2
Accession	P21854
Amino Acid Sequence	Arg117-Asp359, with C-terminal 8* His RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	30-35kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Wu H J. et al. (2009) CD72, a coreceptor with both positive and negative effects on B lymphocyte development and function. J Clin Immunol. 29: 12-21. 2、Adachi T. et al. (2000) CD72 negatively regulates signaling through the antigen receptor of B cells. J Immunol. 164: 1223-1229.

Background

CD72 is a coreceptor of B cell receptor (BCR), which is expressed on all B cells starting at the pre-B cell stage, but its expression decreases significantly during differentiation into plasma cells. CD72 is a transmembrane receptor that is expressed as a homodimer. It has a conserved intracellular domain, which contains an immunoreceptor tyrosine-based inhibitory motif (ITIM) that binds SHP-1, a tyrosine phosphatase, and an ITIM-like motif that binds Grb2, an adaptor protein required to activate the Ras pathway. CD72 is known to play an important role in various B cell processes, including proliferation, apoptosis and differentiation. Mouse CD72 negatively regulates BCR signaling by recruiting Src homology 2 domain-containing protein tyrosine phosphatase-1 (SHP-1) at ITIM.