Frizzled-4/FZD4 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	hFz4, FzE4, CD344, Frizzled 4, Fz-4, EVR1, CD344, FZD4S, FEVR, GPCR
Accession	Q9ULV1
Amino Acid Sequence	Phe37-Glu180, with C-terminal 8*His FGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEEGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	20-28kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Nallathambi J. et al. (2006) Identification of novel FZD4 mutations in Indian patients with familial exudative vitreoretinopathy. Mol Vis. 12: 1086-1092. 2、Sjöblom T. et al. (2006) The consensus coding sequences of human breast and colorectal cancers. Science. 314(5797): 268-274.

Background

Frizzled-4, designated CD344, is a 7-transmembrane glycoprotein of the Frizzled family within the G-protein coupled receptor superfamily. Frizzled proteins function as receptors for Wnt proteins and can activate canonical Wnt/beta-catenin signaling as well as planar cell polarity and calcium flux pathways. Frizzled-4 is particularly important in angiogenic Wnt pathway signaling. Frizzled4 plays a crucial role in maintaining the integrity of the blood-brain barrier/blood-eye barrier, and regulating the expression of related proteins in the Frizzled4/Norrin pathway can regulate the switching of the blood-brain/blood-eye barrier. Frizzled-4 plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP).