Frizzled-7/FZD7 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	FZD7, Frizzled-7, FzE3, Fz-7, hFz7
Accession	O75084
Amino Acid Sequence	Gln33-Leu185, with C-terminal 8*His QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLGGGSHHHHHHHH
Expression System	HEK293
Molecular Weight	25-33kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Sagara N. et al. (1998) Molecular cloning, differential expression, and chromosomal localization of human frizzled-1, frizzled-2, and frizzled-7. Biochem Biophys Res Commun. 252(1): 117-122.

Background

Frizzled-7 is a member of the Frizzled family of unconventional G-protein-coupled glycoprotein receptors for the Wnt signaling pathway. The Wnt genes encode a large family of glycoproteins that are essential in development and tissue maintenance. In the adult, Frizzled-7 is expressed in skeletal muscle, especially in satellite cells that mediate muscle regeneration in response to Wnt-7a. It is expressed in embryonic stem cells (ES), contributing to self-renewal signaling. It has been implicated in mesenchymal-to-epithelial transition in colorectal cancer. Frizzled-7 mRNA has also been detected in adult heart and placenta.