Product Specification| Species | Human | | Synonyms | IGFBP-7, IBP7, MAC25, PSF | | Accession | Q16270 | | Amino Acid Sequence | Asp30-Leu282, with N-terminal 10*His
HHHHHHHHHHGGGSGGGSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL | | Expression System | HEK293 | | Molecular Weight | 33-36kDa | | Purity | >95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | His Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1、Lin J. et al. (2007) Methylation patterns of IGFBP7 in colon cancer cell lines are associated with levels of gene expression. J Pathol. 212(1): 83-90. |
BackgroundInsulin-like growth factor binding protein-7 (IGFBP7) is a member of the IGFBP family, which binds insulin with high affinity and IGF with low affinity. IGFBP7 was originally identified in normal mammary epithelial cells and meningeal cells, and its expression pattern varies with tumor type. In some tumors, IGFBP7 exhibits tumor suppressor activity in certain cancer types via regulation of cell proliferation, apoptosis, cell adhesion epithelial mesenchymal transition (EMT) and angiogenesis. However, IGFBP7 acts as a cancer-promoting gene in esophageal adenocarcinoma and neck squamous cell carcinomas. Together, IGFBP7 may provide potential value for the immunotherapy of cancer. bio-equip.cn
AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|