IGFBP-7 His Tag Protein, Human,specification,price,image-Bio-Equip in China

Product Detail
Company Profile

Product Specification

Species	Human
Synonyms	IGFBP-7, IBP7, MAC25, PSF
Accession	Q16270
Amino Acid Sequence	Asp30-Leu282, with N-terminal 10*His HHHHHHHHHHGGGSGGGSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Expression System	HEK293
Molecular Weight	33-36kDa
Purity	>95% by SDS-PAGE
Endotoxin	<0.1EU/μg
Conjugation	Unconjugated
Tag	His Tag
Physical Appearance	Lyophilized Powder
Storage Buffer	PBS, pH7.4
Reconstitution	Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage	· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Reference	1、Lin J. et al. (2007) Methylation patterns of IGFBP7 in colon cancer cell lines are associated with levels of gene expression. J Pathol. 212(1): 83-90.

Background

Insulin-like growth factor binding protein-7 (IGFBP7) is a member of the IGFBP family, which binds insulin with high affinity and IGF with low affinity. IGFBP7 was originally identified in normal mammary epithelial cells and meningeal cells, and its expression pattern varies with tumor type. In some tumors, IGFBP7 exhibits tumor suppressor activity in certain cancer types via regulation of cell proliferation, apoptosis, cell adhesion epithelial mesenchymal transition (EMT) and angiogenesis. However, IGFBP7 acts as a cancer-promoting gene in esophageal adenocarcinoma and neck squamous cell carcinomas. Together, IGFBP7 may provide potential value for the immunotherapy of cancer.