Product Specification| Species | Human | | Antigen | CLEC7A | | Synonyms | BGR, CANDF4, CD369, CLECSF12, DECTIN1, SCARE2 | | Accession | Q9BXN2 | | Amino Acid Sequence | Thr66-Met247, with C-terminal Human IgG Fc TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK | | Expression System | HEK293 | | Molecular Weight | 55-72kDa (Reducing) | | Purity | ＞95% by SDS-PAGE | | Endotoxin | <0.1EU/μg | | Conjugation | Unconjugated | | Tag | Human Fc Tag | | Physical Appearance | Lyophilized Powder | | Storage Buffer | PBS, pH7.4 | | Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. | | Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
| | Reference | 1.Yaqiong Wang,Xianzhe Li, Xialian Xu,Jinbo Yu, Xiaohong Chen, Xuesen Cao,Jianzhou Zou,BoShen and Xiaoqiang Ding. Clec7a expressionin inflammatory macrophages orchestrates progression of acute kidney injury. Frontiers in Immunology.
|
BackgroundC-type
lectin domain family 7 member A (Clec7a, or Dectin-1) is a transmembrane
protein containing an intracellular immunoreceptor tyrosine-based activation (ITAM)-like
motif and an extracellular C-type lectin-like domain for recognition. Clec7a is
expressed by macrophages and some other immune cells and is believed to control
the innate immune responses to pathogens and the phagocytotic properties, through
regulating phagocytosis and production of reactive oxygen species (ROS).
Moreover, a recent study has shown that Clec7a is critical for macrophage
polarization during renal interstitial fibrosis.
bio-equip.cn AntBio is a biotechnology group company dedicated to serving life sciences, aiming to help scientists accelerate research and improve work efficiency. AntBio provides comprehensive and high-quality reagent tools for basic research, drug development, and diagnosis, including research grade antibodies, proteins, biochemical reagents, and assay kits. These research tools are widely used in different segments of life science research. The group company currently consists of three brands, Absin, Starter-Bio and UA-Bio.
|
中文
